Zinc Finger Protein 548 (ZNF548) antibody

Antigen: Zinc Finger Protein 548 (ZNF548)

Synonyms: FLJ32932

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN309813

Additional Information

Alternative name: ZNF548

Gene ID: ZNF548

UniProt: Q8NEK5

Immunogen: The immunogen for anti-ZNF548 antibody: synthetic peptide directed towards the N terminal of human ZNF548

Sequence: VHMAEEIFTCMEGWKDLPATSCLLQHQGPQSEWKPYRDTE DREAFQTGQN

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF548 antibody concentration is 1 mg/ml.

Description: ZNF548 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 11 C2H2-type zinc fingers and 1 KRAB domain. ZNF548 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 533 amino acids

Molecular Weight: 63kDa

Application Details

Application Notes: WB Suggested Anti-ZNF548 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF548 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Transfected 293T

Publications

Product: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).