Zinc Finger Protein 596 (ZNF596) antibody

Antigen: Zinc Finger Protein 596 (ZNF596)

Synonyms: FLJ36123, ZNF596, PRDM9, MGC151913

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Zebrafish, Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN309816

Additional Information

Alternative name: ZNF596

Gene ID: ZNF596

UniProt: Q8TC21

Immunogen: The immunogen for anti-ZNF596 antibody: synthetic peptide directed towards the C terminal of human ZNF596

Sequence: AFNRSYNFRLHRRVHTGEKPYVCPLCGKAFSKFFNLRQHE RTHTKKAMNM

Cross-Reactivity: Cow (Bovine), Chicken, Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF596 antibody concentration is 1 mg/ml.

Description: ZNF596 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.

Characteristics: Antigen Size: 504 amino acids

Molecular Weight: 58kDa

Application Details

Application Notes: WB Suggested Anti-ZNF596 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF596 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate

Publications

Product: Nusbaum, Mikkelsen, Zody et al.: "DNA sequence and analysis of human chromosome 8." in: Nature, Vol. 439, Issue 7074, pp. 331-5, 2006 (PubMed).