Annexin A8-Like 2 (ANXA8L2) antibody

Antigen: Annexin A8-Like 2 (ANXA8L2)

Synonyms: ANXA8, FLJ32754, FLJ54151, bA145E20.2, ANXA8L1, ANXA8L2

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Chicken, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN309827

Additional Information

Alternative name: ANXA8L2

Gene ID: ANXA8L2

UniProt: Q5VT79

Immunogen: The immunogen for anti-ANXA8L2 antibody: synthetic peptide directed towards the N terminal of human ANXA8L2

Sequence: PDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAKSFK AQFGKDLTET

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rabbit, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ANXA8L2 antibody concentration is 1 mg/ml.

Description: ANXA8L2 is a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. ANXA8L2 may function as an an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of ANXA8L2 has been associated with acute myelocytic leukemia.This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.

Characteristics: Antigen Size: 327 amino acids

Molecular Weight: 37kDa

Application Details

Application Notes: WB Suggested Anti-ANXA8L2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ANXA8L2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: MCF7 cell lysate

Publications

Product: Karanjawala, Illei, Ashfaq et al.: "New markers of pancreatic cancer identified through differential gene expression analyses: claudin 18 and annexin A8." in: The American journal of surgical pathology, Vol. 32, Issue 2, pp. 188-96, 2008 (PubMed).