BTB (POZ) Domain-Containing Protein KCTD4 (KCTD4) antibody

Antigen: BTB (POZ) Domain-Containing Protein KCTD4 (KCTD4)

Synonyms: AU017169, 2210017A09Rik, bA321C24.3, KCTD4

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN309833

Additional Information

Alternative name: KCTD4

Gene ID: KCTD4

UniProt: Q8WVF5

Immunogen: The immunogen for anti-KCTD4 antibody: synthetic peptide directed towards the middle region of human KCTD4

Sequence: RSQGLRIFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSIS SNIIQFKYFI

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-KCTD4 antibody concentration is 1 mg/ml.

Description: KCTD4 contains 1 BTB (POZ) domain. The exact function of KCTD4 remains unknown.

Characteristics: Antigen Size: 259 amino acids

Molecular Weight: 30kDa

Application Details

Application Notes: WB Suggested Anti-KCTD4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Metabolism, Transporters

Restrictions: For Research Use only

Images

WB Suggested Anti-KCTD4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart

Publications

Product: Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).