Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309858

Meis Homeobox 1 (MEIS1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
C530044H18Rik, Evi8, cb224, meis1.1, id:ibd5078, wu:fb38b03, wu:fc02e11, wu:fd12a02, meis, 1323/07, 1422/04, CG17117, Dm-HTH, Dmel\\CG17117, HTH, Hth, Meis1, P53, anon-EST:Liang-2.13, clone 2.13, dtl, ... show more
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309858
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MEIS1 antibody: synthetic peptide directed towards the C terminal of human MEIS1
Sequence AVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMN MGMEGQWHYM
Predicted Reactivity Bovine : 100%, Chicken : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%, African clawed frog : 92%
Characteristics This is a rabbit polyclonal antibody against MEIS1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MEIS1
Background Homeobox genes, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development. In addition, several homeoproteins are involved in neoplasia. MEIS1 is a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins.Homeobox genes, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development. In addition, several homeoproteins are involved in neoplasia. This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins.
Molecular Weight 43kDa
Gene ID 4211
NCBI Accession NP_002389, NM_002398
UniProt O00470
Research Area Stem Cells, Hematopoietic Progenitors, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MEIS1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Robinson, Cheung, Kolaris et al.: "Prospective tracing of MLL-FRYL clone with low MEIS1 expression from emergence during neuroblastoma treatment to diagnosis of myelodysplastic syndrome." in: Blood, Vol. 111, Issue 7, pp. 3802-12, 2008 (PubMed).

Alternatives for antigen "Meis Homeobox 1 (MEIS1)", type "Antibodies"
Hosts (30), (6), (2)
Reactivities (34), (24), (17), (16), (15), (13), (12), (4), (2), (1), (1), (1)
Applications (24), (13), (10), (8), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (3), (2), (2), (1), (1), (1), (1), (1)
Beacon