Did you know that you can buy products from over 140 different suppliers from us?

Meis Homeobox 1 (MEIS1) (C-Term) antibody

Details for Product No. ABIN309858
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
C530044H18Rik, Evi8, cb224, meis1.1, id:ibd5078, wu:fb38b03, wu:fc02e11, wu:fd12a02, meis, 1323/07, 1422/04, CG17117, Dm-HTH, Dmel\\CG17117, HTH, Hth, Meis1, P53, anon-EST:Liang-2.13, clone 2.13, dtl, ... show more
C530044H18Rik, Evi8, cb224, meis1.1, id:ibd5078, wu:fb38b03, wu:fc02e11, wu:fd12a02, meis, 1323/07, 1422/04, CG17117, Dm-HTH, Dmel\\CG17117, HTH, Hth, Meis1, P53, anon-EST:Liang-2.13, clone 2.13, dtl, hth1, hth2, l(3)05745, l(3)86Ca show less
Epitope
C-Term
(7), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Dog (Canine), Human, Chicken
(33), (20), (15), (14), (14), (12), (12), (2), (1), (1)
Host
Rabbit
(27), (5), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(22), (11), (10), (5), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN309858
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human MEIS1
Sequence AVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMN MGMEGQWHYM
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 100 %, African clawed frog : 90 %
Characteristics This is a rabbit polyclonal antibody against MEIS1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MEIS1
Background Homeobox genes, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development. In addition, several homeoproteins are involved in neoplasia. MEIS1 is a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins.Homeobox genes, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development. In addition, several homeoproteins are involved in neoplasia. This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins.
Molecular Weight 43 kDa
Gene ID 4211
NCBI Accession NM_002398, NP_002389
UniProt O00470
Research Area Stem Cells, Hematopoietic Progenitors, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 390 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Robinson, Cheung, Kolaris et al.: "Prospective tracing of MLL-FRYL clone with low MEIS1 expression from emergence during neuroblastoma treatment to diagnosis of myelodysplastic syndrome." in: Blood, Vol. 111, Issue 7, pp. 3802-12, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN309858
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top