Zinc Finger and BTB Domain Containing 6 (ZBTB6) antibody

Antigen: Zinc Finger and BTB Domain Containing 6 (ZBTB6)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN309912

Additional Information

Alternative name: ZBTB6

Gene ID: ZBTB6

UniProt: Q15916

Immunogen: The immunogen for anti-ZBTB6 antibody: synthetic peptide directed towards the N terminal of human ZBTB6

Sequence: MAAESDVLHFQFEQQGDVVLQKMNLLRQQNLFCDVSIYIN DTEFQGHKVI

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZBTB6 antibody concentration is 1 mg/ml.

Description: ZBTB6 Contains 1 BTB (POZ) domain and 4 C2H2-type zinc fingers. It may be involved in transcriptional regulation.

Characteristics: Antigen Size: 424 amino acids

Molecular Weight: 48kDa

Application Details

Application Notes: WB Suggested Anti-ZBTB6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZBTB6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate

Publications

Product: Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).