CXXC Finger Protein 1 (CXXC1) antibody

Antigen: CXXC Finger Protein 1 (CXXC1)

Synonyms: CFP1, CGBP, SPP1, PCCX1, PHF18, hCGBP, HsT2645, 2410002I16Rik, 5830420C16Rik, Cfp1, Cgbp, AI426635

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN309931

Additional Information

Alternative name: CpG-binding protein

Gene ID: CXXC1

UniProt: Q9P0U4

Immunogen: The immunogen for anti-CXXC1 antibody: synthetic peptide directed towards the C terminal of human CXXC1

Sequence: RVWYKLDELFEQERNVRTAMTNRAGLLALMLHQTIQHDPL TTDLRSSADR

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-CXXC1 antibody concentration is 1 mg/ml.

Description: Proteins that contain a CXXC motif within their DNA-binding domain, such as CXXC1, recognize CpG sequences and regulate gene expression.Proteins that contain a CXXC motif within their DNA-binding domain, such as CXXC1, recognize CpG sequences and regulate gene expression (Carlone and Skalnik, 2001).[supplied by OMIM].

Characteristics: Antigen Size: 656 amino acids

Molecular Weight: 76kDa

Application Details

Application Notes: WB Suggested Anti-CXXC1 Antibody Titration: 0.625ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-CXXC1 Antibody Titration: 0.625ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T

Publications

Product: Lee, Skalnik: "CpG-binding protein (CXXC finger protein 1) is a component of the mammalian Set1 histone H3-Lys4 methyltransferase complex, the analogue of the yeast Set1/COMPASS complex." in: The Journal of biological chemistry, Vol. 280, Issue 50, pp. 41725-31, 2005 (PubMed).