Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 432 (ZNF432) antibody

Antigen

Zinc Finger Protein 432 (ZNF432)

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN309932
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ZNF432
Gene ID ZNF432
UniProt O94892
Immunogen The immunogen for anti-ZNF432 antibody: synthetic peptide directed towards the C terminal of human ZNF432
Sequence GKGFTMKSRLIVHQRTHTGEKPFVCSECRKAFSSKRNLIV HQRTHNGNKP
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ZNF432 antibody concentration is 1 mg/ml.
Description ZNF432 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 16 C2H2-type zinc fingers and 1 KRAB domain. ZNF432 may be involved in transcriptional regulation.
Characteristics Antigen Size: 652 amino acids
Molecular Weight 75kDa

Application Details

Application Notes WB Suggested Anti-ZNF432 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only

Publications

Product Zhan, Desiderio: "Nitroproteins from a human pituitary adenoma tissue discovered with a nitrotyrosine affinity column and tandem mass spectrometry." in: Analytical biochemistry, Vol. 354, Issue 2, pp. 279-89, 2006 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger Protein 432 (ZNF432)", type "Antibodies"
Hosts Rabbit (5)
Reactivities Human (5)
Applications Western Blotting (WB) (5), ELISA (2)
Epitopes N-Term (2), C-Term (1)