Zinc Finger Protein 408 (ZNF408) antibody

Antigen: Zinc Finger Protein 408 (ZNF408)

Synonyms: FLJ12827, Gm1011, RP23-176N9.6

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN309957

Additional Information

Alternative name: ZNF408

Gene ID: ZNF408

UniProt: Q9H9D4

Immunogen: The immunogen for anti-ZNF408 antibody: synthetic peptide directed towards the N terminal of human ZNF408

Sequence: MEEAEELLLEGKKALQLAREPRLGLDLGWNPSGEGCTQGL KDVPPEPTRD

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF408 antibody concentration is 1 mg/ml.

Description: ZNF408 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 720 amino acids

Molecular Weight: 78kDa

Application Details

Application Notes: WB Suggested Anti-ZNF408 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF408 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T

Publications

Product: Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).