Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309966

Single Stranded DNA Binding Protein 4 (SSBP4) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Sspb4, AW743380, 1210002E11Rik, si:ch211-202n20.1, ssbp, wu:fb33f07, SSBP4
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309966
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SSBP4 antibody: synthetic peptide directed towards the N terminal of human SSBP4
Sequence MYAKGGKGSAVPSDSQAREKLALYVYEYLLHIGAQKSAQT FLSEIRWEKN
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, African clawed frog : 92%, Guinea pig : 92%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against SSBP4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SSBP4
Background SSBP4 contains 1 LisH domain. The exact function of SSBP4 remains unknown.
Molecular Weight 37kDa
Gene ID 170463
NCBI Accession NP_001009998, NM_001009998
UniProt Q9BWW5
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SSBP4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ballif, Villén, Beausoleil et al.: "Phosphoproteomic analysis of the developing mouse brain." in: Molecular & cellular proteomics : MCP, Vol. 3, Issue 11, pp. 1093-101, 2004 (PubMed).

Alternatives for antigen "Single Stranded DNA Binding Protein 4 (SSBP4)", type "Antibodies"
Hosts (5), (3)
Reactivities (8), (2), (2), (2), (2), (1), (1), (1)
Applications (8), (3), (2)
Epitopes (2), (2), (1), (1), (1), (1)
Beacon