Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309967

Single Stranded DNA Binding Protein 4 (SSBP4) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Sspb4, AW743380, 1210002E11Rik, si:ch211-202n20.1, ssbp, wu:fb33f07, SSBP4
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN309967
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SSBP4 antibody: synthetic peptide directed towards the C terminal of human SSBP4
Sequence DGLPKSSPGAVAGLSNAPGTPRDDGEMAAAGTFLHPFPSE SYSPGMTMSV
Predicted Reactivity Dog : 100%, Human : 100%, Mouse : 100%, Rat : 100%, African clawed frog : 92%, Bovine : 92%, Guinea pig : 92%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against SSBP4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SSBP4
Background SSBP4 contains 1 LisH domain. The exact function of SSBP4 remains unknown.
Molecular Weight 37kDa
Gene ID 170463
NCBI Accession NP_001009998, NM_001009998
UniProt Q9BWW5
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SSBP4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ballif, Villén, Beausoleil et al.: "Phosphoproteomic analysis of the developing mouse brain." in: Molecular & cellular proteomics : MCP, Vol. 3, Issue 11, pp. 1093-101, 2004 (PubMed).

Alternatives for antigen "Single Stranded DNA Binding Protein 4 (SSBP4)", type "Antibodies"
Hosts (5), (3)
Reactivities (8), (2), (2), (2), (2), (1), (1), (1), (1)
Applications (8), (3), (2)
Epitopes (2), (2), (1), (1), (1), (1)
Beacon