Single Stranded DNA Binding Protein 4 (SSBP4) (C-Term) antibody

Details for Product No. ABIN309967
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Sspb4, AW743380, 1210002E11Rik, si:ch211-202n20.1, ssbp, wu:fb33f07, SSBP4
Epitope
C-Term
(2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(8), (2), (2), (2), (2), (1), (1), (1), (1)
Host
Rabbit
(5), (3)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN309967
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human SSBP4
Sequence DGLPKSSPGAVAGLSNAPGTPRDDGEMAAAGTFLHPFPSE SYSPGMTMSV
Predicted Reactivity Dog : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, African clawed frog : 90 %, Bovine : 90 %, Guinea pig : 90 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against SSBP4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SSBP4
Background SSBP4 contains 1 LisH domain. The exact function of SSBP4 remains unknown.
Molecular Weight 37 kDa
Gene ID 170463
NCBI Accession NM_001009998, NP_001009998
UniProt Q9BWW5
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 363 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Ballif, Villén, Beausoleil et al.: "Phosphoproteomic analysis of the developing mouse brain." in: Molecular & cellular proteomics : MCP, Vol. 3, Issue 11, pp. 1093-101, 2004 (PubMed).

Hosts (5), (3)
Reactivities (8), (2), (2), (2), (2), (1), (1), (1), (1)
Applications (8), (2), (1)
Epitopes (2), (2), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top