Zinc Finger Protein 514 (ZNF514) (N-Term) antibody

Details for Product No. ABIN309968
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Epitope
N-Term
(3), (2), (1), (1), (1)
Reactivity
Cow (Bovine), Human
(9)
Host
Rabbit
(7), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(9), (2)
Pubmed 1 reference available
Catalog no. ABIN309968
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF514
Sequence MTFEDVAVEFSQWEWGQLNPAQKDLYREVMLENFRNLAIL GLLVSKPYVI
Predicted Reactivity Human : 100 %, Horse : 90 %, Bovine : 80 %, Pig : 70 %
Characteristics This is a rabbit polyclonal antibody against ZNF514. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF514
Background ZNF514 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers and 1 KRAB domain. ZNF514 may be involved in transcriptional regulation.
Molecular Weight 46 kDa
Gene ID 84874
NCBI Accession NM_032788, NP_116177
UniProt Q96K75
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 400 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 514 (ZNF514) (N-Term) antibody WB Suggested Anti-ZNF514 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4...." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Hosts (7), (2)
Reactivities (9)
Applications (9), (2)
Epitopes (3), (2), (1), (1), (1)
back to top