Zinc Finger Protein 514 (ZNF514) antibody

Antigen: Zinc Finger Protein 514 (ZNF514)

Synonyms: MGC126229, MGC126230

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human

Application: Western Blotting (WB)

Catalog no.: ABIN309968

Additional Information

Alternative name: ZNF514

Gene ID: ZNF514

UniProt: Q96K75

Immunogen: The immunogen for anti-ZNF514 antibody: synthetic peptide directed towards the N terminal of human ZNF514

Sequence: MTFEDVAVEFSQWEWGQLNPAQKDLYREVMLENFRNLAIL GLLVSKPYVI

Cross-Reactivity: Cow (Bovine), Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF514 antibody concentration is 1 mg/ml.

Description: ZNF514 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers and 1 KRAB domain. ZNF514 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 400 amino acids

Molecular Weight: 46kDa

Application Details

Application Notes: WB Suggested Anti-ZNF514 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF514 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate

Publications

Product: Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).