Zinc Finger Protein 296 (ZNF296) (N-Term) antibody

Details for Product No. ABIN309972
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms ZFP296, ZNF342
Epitope
N-Term
(4), (2), (1), (1)
Reactivity
Human
(20), (16), (16), (12), (5)
Host
Rabbit
(20)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(11), (10), (3), (3), (2)
Pubmed 2 references available
Catalog no. ABIN309972
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF342
Sequence KLLRHAQWDHGLSIYQTESEAPEAPLLGLAEVAAAVSAVV GPAAEAKSPR
Predicted Reactivity Human :100 %,   Streptomyces griseoflavus Tu4000 :70 %,  
Characteristics This is a rabbit polyclonal antibody against ZNF342. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF342
Background ZNF342 contains 6 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. It may be involved in transcriptional regulation.
Molecular Weight 51 kDa
Gene ID 162979
NCBI Accession NM_145288, NP_660331
UniProt Q8WUU4
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 475 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Hong, Bollen, Costello: "The contribution of genetic and epigenetic mechanisms to gene silencing in oligodendrogliomas." in: Cancer research, Vol. 63, Issue 22, pp. 7600-5, 2003 (PubMed).

General Hong, Hansen, Yan et al.: "Beta-glucan functions as an adjuvant for monoclonal antibody immunotherapy by recruiting tumoricidal granulocytes as killer cells." in: Cancer research, Vol. 63, Issue 24, pp. 9023-31, 2003 (PubMed).

Hosts (20)
Reactivities (20), (16), (16), (12), (5)
Applications (11), (10), (3), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (1), (1)
back to top