Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 296 (ZNF296) antibody

Antigen

Zinc Finger Protein 296 (ZNF296)

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
2 references available
Catalog no. ABIN309972
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ZNF296
Gene ID ZNF342
UniProt Q8WUU4
Immunogen The immunogen for anti-ZNF342 antibody: synthetic peptide directed towards the N terminal of human ZNF342
Sequence KLLRHAQWDHGLSIYQTESEAPEAPLLGLAEVAAAVSAVV GPAAEAKSPR
Cross-Reactivity Human
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ZNF342 antibody concentration is 1 mg/ml.
Description ZNF342 contains 6 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. It may be involved in transcriptional regulation.
Characteristics Antigen Size: 475 amino acids
Molecular Weight 51kDa

Application Details

Application Notes WB Suggested Anti-ZNF342 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Hong, Hansen, Yan et al.: "Beta-glucan functions as an adjuvant for monoclonal antibody immunotherapy by recruiting tumoricidal granulocytes as killer cells." in: Cancer research, Vol. 63, Issue 24, pp. 9023-31, 2003 (PubMed).

Product Hong, Bollen, Costello: "The contribution of genetic and epigenetic mechanisms to gene silencing in oligodendrogliomas." in: Cancer research, Vol. 63, Issue 22, pp. 7600-5, 2003 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger Protein 296 (ZNF296)", type "Antibodies"
Hosts Rabbit (27)
Reactivities Human (27), Dog (Canine) (5), Cow (Bovine) (4), Mouse (Murine) (4)
Applications Immunofluorescence (IF) (15), Western Blotting (WB) (12), ELISA (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunohistochemistry (IHC) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes C-Term (2), Internal Region (1), N-Term (1)