Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 485 (ZNF485) antibody

Antigen

Zinc Finger Protein 485 (ZNF485)

Synonyms ZNF485
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Human, Mouse (Murine)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN309973
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ZNF485
Gene ID ZNF485
UniProt Q8NCK3
Immunogen The immunogen for anti-ZNF485 antibody: synthetic peptide directed towards the N terminal of human ZNF485
Sequence MAPRAQIQGPLTFGDVAVAFTRIEWRHLDAAQRALYRDVM LENYGNLVSV
Cross-Reactivity Human, Mouse (Murine)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ZNF485 antibody concentration is 1 mg/ml.
Description ZNF485 contains 1 KRAB domain and 11 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and may be involved intranscriptional regulation.
Characteristics Antigen Size: 402 amino acids
Molecular Weight 46kDa

Application Details

Application Notes WB Suggested Anti-ZNF485 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only

Publications

Product Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger Protein 485 (ZNF485)", type "Antibodies"
Hosts Rabbit (8)
Reactivities Human (8)
Applications Western Blotting (WB) (8), ELISA (2)
Epitopes C-Term (2), N-Term (1)