Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 709 (ZNF709) (N-Term) antibody

Details for Product No. ABIN309975
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF709, BC021921, GIOT-4, HIT-40
Epitope
N-Term
(4)
Reactivity
Rat (Rattus), Human
(6)
Host
Rabbit
(6)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6)
Pubmed 2 references available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN309975
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF709
Sequence DVMQETFVNLASIGENWEEKNIEDHKNQGRKLRSHMVERL CERKEGSQFG
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF709. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name ZNF709
Background ZNF709 may be involved in transcriptional regulation.
Molecular Weight 75 kDa
Gene ID 163051
NCBI Accession NM_152601, NP_689814
UniProt Q8N972
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 641 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 709 (ZNF709) (N-Term) antibody WB Suggested Anti-ZNF709 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Validation Images
back to top