Zinc Finger Protein 709 (ZNF709) antibody

Antigen: Zinc Finger Protein 709 (ZNF709)

Synonyms: FLJ38281, ZNF709, GIOT-4, HIT-40, BC021921, MGC28841, Hit40, Znf14

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN309975

Additional Information

Alternative name: ZNF709

Gene ID: ZNF709

UniProt: Q8N972

Immunogen: The immunogen for anti-ZNF709 antibody: synthetic peptide directed towards the N terminal of human ZNF709

Sequence: DVMQETFVNLASIGENWEEKNIEDHKNQGRKLRSHMVERL CERKEGSQFG

Cross-Reactivity: Human, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ZNF709 antibody concentration is 1 mg/ml.

Description: ZNF709 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 641 amino acids

Molecular Weight: 75kDa

Application Details

Application Notes: WB Suggested Anti-ZNF709 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF709 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).