Zinc Finger Protein 555 (ZNF555) antibody

Antigen: Zinc Finger Protein 555 (ZNF555)

Synonyms: MGC26707

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human

Application: Western Blotting (WB)

Catalog no.: ABIN309978

Additional Information

Alternative name: ZNF555

Gene ID: ZNF555

UniProt: Q8NEP9

Immunogen: The immunogen for anti-ZNF555 antibody: synthetic peptide directed towards the N terminal of human ZNF555

Sequence: DSVVFEDVAVDFTLEEWALLDSAQRDLYRDVMLETFQNLA SVDDETQFKA

Cross-Reactivity: Cow (Bovine), Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF555 antibody concentration is 1 mg/ml.

Description: ZNF555 contains 15 C2H2-type zinc fingers and 1 KRAB domain. It belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.

Characteristics: Antigen Size: 628 amino acids

Molecular Weight: 73kDa

Application Details

Application Notes: WB Suggested Anti-ZNF555 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF555 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human heart

Publications

Product: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).