Zinc Finger Protein 555 (ZNF555) antibody

Antigen: Zinc Finger Protein 555 (ZNF555)

Synonyms: MGC26707

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human

Application: Western Blotting (WB)

Catalog no.: ABIN309979

Additional Information

Alternative name: ZNF555

Gene ID: ZNF555

UniProt: Q8NEP9

Immunogen: The immunogen for anti-ZNF555 antibody: synthetic peptide directed towards the C terminal of human ZNF555

Sequence: LRRHVRIHTTEKQYKCNVGHPPANEFMCSASEKSHQERDL IKVVNMVLPL

Cross-Reactivity: Cow (Bovine), Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF555 antibody concentration is 1 mg/ml.

Description: ZNF555 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 15 C2H2-type zinc fingers and 1 KRAB domain. ZNF555 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 628 amino acids

Molecular Weight: 73kDa

Application Details

Application Notes: WB Suggested Anti-ZNF555 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF555 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate

Publications

Product: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).