Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Zinc Finger Protein 57 (ZFP57) antibody

Antigen

Zinc Finger Protein 57 (ZFP57)

Synonyms ZNF424
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN309984
Quantity 0.1 mg  (Variants)
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ZNF57
Gene ID ZNF57
UniProt Q68EA5
Immunogen The immunogen for anti-ZNF57 antibody: synthetic peptide directed towards the N terminal of human ZNF57
Sequence MDSVVFEDVAVDFTLEEWALLDSAQRDLYRDVMLETFRNL ASVDDGTQFK
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-ZNF57 antibody concentration is 1 mg/ml.
Description The function of ZNF57 remains unkonwn.
Characteristics Antigen Size: 555 amino acids
Molecular Weight 64kDa

Application Details

Application Notes WB Suggested Anti-ZNF57 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only

Publications

Product Lichter, Bray, Ried et al.: "Clustering of C2-H2 zinc finger motif sequences within telomeric and fragile site regions of human chromosomes." in: Genomics, Vol. 13, Issue 4, pp. 999-1007, 1992 (PubMed).

Alternatives

Alternatives for antigen "Zinc Finger Protein 57 (ZFP57)", type "Antibodies"
Hosts Rabbit (6)
Reactivities Human (6), Mouse (Murine) (1)
Applications Western Blotting (WB) (6), ELISA (2)
Epitopes N-Term (2), C-Term (1), N-Term,AA 73-101 (1)