Ribophorin 1 (RPN1) antibody

Antigen: Ribophorin 1 (RPN1)

Synonyms: OST1, RBPH1, DKFZp686B16177, RIBI, Rpn-1, AU018702, D6Wsu137e, RPN1, DKFZp469O2032

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Chicken

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN310034

Additional Information

Alternative name: Ribophorin-1 / RPN1

Gene ID: RPN1

UniProt: P04843

Immunogen: The immunogen for anti-RPN1 antibody: synthetic peptide directed towards the N terminal of human RPN1

Sequence: TSRATSFLLALEPELEARLAHLGVQVKGEDEEENNLEVRE TKIKGKSGRF

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RPN1 antibody concentration is 1 mg/ml.

Description: RPN1 is a type I integral membrane protein found only in the rough endoplasmic reticulum. It is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. RPN1 forms part of the regulatory subunit of the 26S proteasome and may mediate binding of ubiquitin-like domains to this proteasome. This gene encodes a type I integral membrane protein found only in the rough endoplasmic reticulum. The encoded protein is part of an N-oligosaccharyl transferase complex that links high mannose oligosaccharides to asparagine residues found in the Asn-X-Ser/Thr consensus motif of nascent polypeptide chains. This protein forms part of the regulatory subunit of the 26S proteasome and may mediate binding of ubiquitin-like domains to this proteasome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 607 amino acids

Molecular Weight: 69kDa

Application Details

Application Notes: WB Suggested Anti-RPN1 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RPN1 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate

WB Suggested Anti-RPN1 Antibody
Titration: 1 ug/ml
Positive Control: HeLa and CHO-K1 cell lines, rouch canine microsomes

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).