Small Nuclear Ribonucleoprotein Polypeptide A' (SNRPA1) antibody

Antigen: Small Nuclear Ribonucleoprotein Polypeptide A' (SNRPA1)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis, Chicken, Dog (Canine), Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN310035

Additional Information

Alternative name: SnRNP A / SNRPA1

Gene ID: SNRPA1

UniProt: P09661

Immunogen: The immunogen for anti-SNRPA1 antibody: synthetic peptide directed towards the N terminal of human SNRPA1

Sequence: VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATL DQFDAIDFSD

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SNRPA1 antibody concentration is 1 mg/ml.

Description: SNRPA1 contains 3 LRR (leucine-rich) repeats and belongs to the U2 small nuclear ribonucleoprotein A family. It is associated with sn-RNP U2 and helps the A' protein to bind stem loop IV of U2 snRNA.

Characteristics: Antigen Size: 255 amino acids

Molecular Weight: 28kDa

Application Details

Application Notes: WB Suggested Anti-SNRPA1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SNRPA1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).