Splicing Factor 3a, Subunit 1 (SF3A1) antibody

Antigen: Splicing Factor 3a, Subunit 1 (SF3A1)

Synonyms: AI159724, 1200014H24Rik, 5930416L09Rik, DmelCG16941, SF3a120, MGC65786, MGC77239, zgc:65786, wu:fc38e01, wu:fc50a11, wu:fj37c05, si:dz150f13.2

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Fruit Fly (Drosophila melanogaster), Dog (Canine), Chicken, Zebrafish, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN310053

Additional Information

Alternative name: SF3A1 / SAP114

Gene ID: SF3A1

UniProt: Q15459

Immunogen: The immunogen for anti-SF3A1 antibody: synthetic peptide directed towards the N terminal of human SF3A1

Sequence: QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSIS AFDLDVVKLT

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Fruit Fly (Drosophila melanogaster), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SF3A1 antibody concentration is 1 mg/ml.

Description: SF3A1 is the subunit 1 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 1 belongs to the SURP protein family, named for the SURP motifs that are thought to mediate RNA binding. Subunit 1 has tandemly repeated SURP motifs in its amino-terminal half while its carboxy-terminal half contains a proline-rich region and a ubiquitin-like domain. Binding studies with truncated subunit 1 derivatives demonstrated that the two SURP motifs are necessary for binding to subunit 3 while contacts with subunit 2 may occur through sequences carboxy-terminal to the SURP motifs.This gene encodes subunit 1 of the splicing factor 3a protein complex. The splicing factor 3a heterotrimer includes subunits 1, 2 and 3 and is necessary for the in vitro conversion of 15S U2 snRNP into an active 17S particle that performs pre-mRNA splicing. Subunit 1 belongs to the SURP protein family, named for the SURP (also called SWAP or Suppressor-of-White-APricot) motifs that are thought to mediate RNA binding. Subunit 1 has tandemly repeated SURP motifs in its amino-terminal half while its carboxy-terminal half contains a proline-rich region and a ubiquitin-like domain. Binding studies with truncated subunit 1 derivatives demonstrated that the two SURP motifs are necessary for binding to subunit 3 while contacts with subunit 2 may occur through sequences carboxy-terminal to the SURP motifs. Alternative splicing results in multiple transcript variants encoding different isoforms.

Characteristics: Antigen Size: 793 amino acids

Molecular Weight: 89kDa

Application Details

Application Notes: WB Suggested Anti-SF3A1 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SF3A1 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).