serine/arginine-Rich Splicing Factor 6 (SRSF6) antibody

Antigen: serine/arginine-Rich Splicing Factor 6 (SRSF6)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Chicken, Zebrafish, Xenopus laevis

Application: Western Blotting (WB)

Catalog no.: ABIN310057

Additional Information

Alternative name: SFRS6

Gene ID: SFRS6

UniProt: Q13247

Immunogen: The immunogen for anti-SFRS6 antibody: synthetic peptide directed towards the middle region of human SFRS6

Sequence: KERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDK PRTSHRRSYS

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SFRS6 antibody concentration is 1 mg/ml.

Description: SFRS6 is involved in mRNA splicing and may play a role in the determination of alternative splicing. It belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12.The protein encoded by this gene is involved in mRNA splicing and may play a role in the determination of alternative splicing. The encoded nuclear protein belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 344 amino acids

Molecular Weight: 39kDa

Application Details

Application Notes: WB Suggested Anti-SFRS6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SFRS6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).