KH Domain Containing, RNA Binding, Signal Transduction Associated 1 (KHDRBS1) antibody

Antigen: KH Domain Containing, RNA Binding, Signal Transduction Associated 1 (KHDRBS1)

Synonyms: p62, Sam68, FLJ34027, fj90g10, khdrbs1, MGC113899, wu:fa18g12, wu:fa56c01, wu:fc91b01, wu:fj90g10, zgc:113899, KHDRBS1, MGC137309

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN310066

Additional Information

Alternative name: SAM68 / KHDRBS1

Gene ID: KHDRBS1

UniProt: Q07666

Immunogen: The immunogen for anti-KHDRBS1 antibody: synthetic peptide directed towards the N terminal of human KHDRBS1

Sequence: LPELMAEKDSLDPSFTHAMQLLTAEIEKIQKGDSKKDDEE NYLDLFSHKN

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-KHDRBS1 antibody concentration is 1 mg/ml.

Description: KHDRBS1 recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and insulin receptors. Once phosphorylated, KHDRBS1 functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-containing proteins. KHDRBS1 play a role in G2-M progression in the cell cycle. It represses CBP-dependent transcriptional activation apparently by competing with other nuclear factors for binding to CBP. KHDRBS1 also acts as a putative regulator of mRNA stability and/or translation rates and mediates mRNA nuclear export.

Characteristics: Antigen Size: 443 amino acids

Molecular Weight: 48kDa

Application Details

Application Notes: WB Suggested Anti-KHDRBS1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-KHDRBS1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human heart

Publications

Product: Duran, Linares, Galvez et al.: "The signaling adaptor p62 is an important NF-kappaB mediator in tumorigenesis." in: Cancer cell, Vol. 13, Issue 4, pp. 343-54, 2008 (PubMed).