Cleavage and Polyadenylation Specific Factor 1, 160kDa (CPSF1) antibody

Antigen: Cleavage and Polyadenylation Specific Factor 1, 160kDa (CPSF1)

Synonyms: CPSF1, MGC188689, wu:fb24c01, DKFZp469K0832, CPSF160, P/cl.18, HSU37012, ATCPSF160, cleavage and polyadenylation specificity factor 160, K17N15.21, K17N15_21

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN310073

Additional Information

Alternative name: CPSF1

Gene ID: CPSF1

UniProt: Q10570

Immunogen: The immunogen for anti-CPSF1 antibody: synthetic peptide directed towards the middle region of human CPSF1

Sequence: GCYDMWTVIAPVRKEEEDNPKGEGTEQEPSTTPEADDDGR RHGFLILSRE

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-CPSF1 antibody concentration is 1 mg/ml.

Description: CPSF1 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. This subunit is involved in the RNA recognition step of the polyadenylation reaction.

Characteristics: Antigen Size: 1443 amino acids

Molecular Weight: 161kDa

Application Details

Application Notes: WB Suggested Anti-CPSF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, DNA/RNA

Restrictions: For Research Use only

Images

WB Suggested Anti-CPSF1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T

Publications

Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).