Did you know that you can buy products from over 140 different suppliers from us?

Pre-MRNA Branch Site Protein p14 (SF3B14) (Middle Region) antibody

Details for Product No. ABIN310082
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 6030419K15Rik, AV001342, Sf3b14, HSPC175, Ht006, P14, SAP14, SF3B14a, zgc:86708
Epitope
Middle Region
(4), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Xenopus laevis, Zebrafish (Danio rerio), Cow (Bovine), Dog (Canine), Human, Chicken
(16), (8), (1), (1), (1), (1), (1)
Host
Rabbit
(18)
Clonality
Polyclonal
Application
Western Blotting (WB)
(18), (8), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310082
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SF3B14
Sequence HLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKE KYGINTDPPK
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Human : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against SF3B14. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SF3B14
Background SF3B14 is a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. SF3B14 also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site.This gene encodes a 14 kDa protein subunit of the splicing factor 3b complex. Splicing factor 3b associates with both the U2 and U11/U12 small nuclear ribonucleoprotein complexes (U2 snRNP) of spliceosomes. This 14 kDa protein interacts directly with subunit 1 of the splicing factor 3b complex. This 14 kDa protein also interacts directly with the adenosine that carries out the first transesterification step of splicing at the pre-mRNA branch site.
Molecular Weight 14 kDa
Gene ID 51639
NCBI Accession NM_016047, NP_057131
UniProt Q7RTV0
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 125 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310082
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top