Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310090

Spermatid Perinuclear RNA Binding Protein (STRBP) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ILF3L, SPNR, p74, 6430510M02Rik, AI852513, C230082I21Rik, C86322, Spnr
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310090
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-STRBP antibody: synthetic peptide directed towards the middle region of human STRBP
Sequence PSKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNE SKNETVSSNS
Predicted Reactivity Human : 100%, Rabbit : 100%, Bovine : 92%, Chicken : 92%, Dog : 92%, Horse : 92%, Mouse : 92%, Rat : 92%, African clawed frog : 85%, Guinea pig : 85%
Characteristics This is a rabbit polyclonal antibody against STRBP. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name STRBP
Background STRBP contains 2 DRBM (double-stranded RNA-binding) domains and 1 DZF domain. STRBP is involved in spermatogenesis and sperm function. It plays a role in regulation of cell growth.
Molecular Weight 74kDa
Gene ID 55342
NCBI Accession NP_060857, NM_018387
UniProt Q96SI9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-STRBP antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Spermatid Perinuclear RNA Binding Protein (STRBP)", type "Antibodies"
Hosts (5)
Reactivities (3), (2), (2), (1)
Applications (5), (3)
Epitopes (1)
Beacon