Chromosome 7 Open Reading Frame 64 (C7orf64) antibody

Antigen: Chromosome 7 Open Reading Frame 64 (C7orf64)

Synonyms: HSPC304, DKFZP564O0523, DKFZp686D1651

Clonality: Polyclonal

Host: Rabbit

Reactivity: Chicken, Human, Rat (Rattus), Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN310102

Additional Information

Alternative name: C7orf64

Gene ID: DKFZP564O0523

UniProt: Q5RL73

Immunogen: The immunogen for anti-DKFZP564O0523 antibody: synthetic peptide directed towards the C terminal of human DKFZP564O0523

Sequence: FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHK LKEVISSVPK

Cross-Reactivity: Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-DKFZP564O0523 antibody concentration is 1 mg/ml.

Description: The exact functions of DKFZP564O0523 remain unknown.

Characteristics: Antigen Size: 367 amino acids

Molecular Weight: 42kDa

Application Details

Application Notes: WB Suggested Anti-DKFZP564O0523 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-DKFZP564O0523 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate

Publications

Product: Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).