C7orf64 antibody (C-Term)

Catalog No. ABIN633543

Product Details anti-C7orf64 Antibody

Target: C7orf64 (Chromosome 7 Open Reading Frame 64 (C7orf64))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C7orf64 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DKFZP564 O0523 antibody was raised against the C terminal of DKFZP564 0523

Purification: Affinity purified

Immunogen: DKFZP564 O0523 antibody was raised using the C terminal of DKFZP564 0523 corresponding to a region with amino acids FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DKFZP564O0523 Blocking Peptide, catalog no. 33R-2980, is also available for use as a blocking control in assays to test for specificity of this DKFZP564O0523 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DKFZP560 0523 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C7orf64

Target: C7orf64 (Chromosome 7 Open Reading Frame 64 (C7orf64))

Alternative Name: DKFZP564O0523 (C7orf64 Products)

Synonyms: C7orf64 antibody, DKFZP564O0523 antibody, HSPC304 antibody, RGD1310794 antibody, AW548102 antibody, C030048B08Rik antibody, dkfzp564o0523 antibody, C4H7orf64 antibody, RNA binding motif protein 48 antibody, rbm48 antibody, RBM48 antibody, Rbm48 antibody

Background: The function of DKFZP564O0523 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 42 kDa (MW of target protein)