NOP2/Sun Domain Family, Member 6 (NSUN6) antibody

Antigen: NOP2/Sun Domain Family, Member 6 (NSUN6)

Synonyms: NOPD1, FLJ23743, 4933414E04Rik

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN310124

Additional Information

Alternative name: NSUN6

Gene ID: NSUN6

UniProt: Q8TEA1

Immunogen: The immunogen for anti-NSUN6 antibody: synthetic peptide directed towards the N terminal of human NSUN6

Sequence: MSIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFE TLLKHLSHPP

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-NSUN6 antibody concentration is 1 mg/ml.

Description: NSUN6 may have S-adenosyl-L-methionine-dependent methyl-transferase activity (Potential). NSUN6 belongs to the methyltransferase superfamily, RsmB/NOP family. It contains 1 PUA domain.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.

Characteristics: Antigen Size: 469 amino acids

Molecular Weight: 52kDa

Application Details

Application Notes: WB Suggested Anti-NSUN6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human muscle.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-NSUN6 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human muscle

Publications

Product: Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).