Chromosome 11 Open Reading Frame 54 (C11orf54) antibody

Antigen: Chromosome 11 Open Reading Frame 54 (C11orf54)

Synonyms: PTD012, C29H11orf54, C11orf54, MGC128152, MGC81809

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Rat (Rattus), Mouse (Murine), Dog (Canine), Xenopus laevis, Zebrafish

Application: Western Blotting (WB)

Catalog no.: ABIN310180

Additional Information

Alternative name: C11orf54

Gene ID: C11orf54

UniProt: Q9H0W9

Immunogen: The immunogen for anti-C11orf54 antibody: synthetic peptide directed towards the N terminal of human C11orf54

Sequence: CPDLTKEPFTFPVKGICGKTRIAEVGGVPYLLPLVNQKKV YDLNKIAKEI

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-C11orf54 antibody concentration is 1 mg/ml.

Description: The exact function of C11orf54 remains unknown.

Characteristics: Antigen Size: 265 amino acids

Molecular Weight: 29kDa

Application Details

Application Notes: WB Suggested Anti-C11orf54 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-C11orf54 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle

Publications

Product: Manjasetty, Büssow, Fieber-Erdmann et al.: "Crystal structure of Homo sapiens PTD012 reveals a zinc-containing hydrolase fold." in: Protein science : a publication of the Protein Society, Vol. 15, Issue 4, pp. 914-20, 2006 (PubMed).