Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 7 (CHST7) antibody

Antigen: Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 7 (CHST7)

Synonyms: MGC124926, CHST7, MGC130614

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN310184

Additional Information

Alternative name: CHST7

Gene ID: CHST7

UniProt: Q9NS84

Immunogen: The immunogen for anti-CHST7 antibody: synthetic peptide directed towards the middle region of human CHST7

Sequence: DLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLL RESIQVLRTR

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-CHST7 antibody concentration is 1 mg/ml.

Description: CHST7 belongs to the sulfotransferase family. Sulfotransferases generate sulfated glycosaminoglycan (GAG) moities during chondroitin sulfate biosynthesis. They create considerable structural diversity among chondroitin sulfates by transferring sulfate with remarkable specificity for the underlying oligosaccharide substrate. This protein mainly transfers sulfate to N-acetylgalactosamine. The regulated expression of each member of the family may be an important determinant of sulfated GAGs expression and the associated function of chondroitin sulfates as regulators of many biologic processes.This gene belongs to the sulfotransferase gene family. Sulfotransferases generate sulfated glycosaminoglycan (GAG) moities during chondroitin sulfate biosynthesis. They create considerable structural diversity among chondroitin sulfates by transferring sulfate with remarkable specificity for the underlying oligosaccharide substrate. This gene product mainly transfers sulfate to N-acetylgalactosamine. The regulated expression of each member of this gene family may be an important determinant of sulfated GAGs expression and the associated function of chondroitin sulfates as regulators of many biologic processes. This gene is part of a gene cluster on chromosome Xp11.23.

Characteristics: Antigen Size: 486 amino acids

Molecular Weight: 53kDa

Application Details

Application Notes: WB Suggested Anti-CHST7 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Metabolism, Extracellular Matrix

Restrictions: For Research Use only

Images

WB Suggested Anti-CHST7 Antibody Titration: 1.25ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Thiselton, McDowall, Brandau et al.: "An integrated, functionally annotated gene map of the DXS8026-ELK1 interval on human Xp11.3-Xp11.23: potential hotspot for neurogenetic disorders." in: Genomics, Vol. 79, Issue 4, pp. 560-72, 2002 (PubMed).