Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Aminolevulinate Dehydratase (ALAD) antibody

Antigen

Aminolevulinate Dehydratase (ALAD)

Synonyms PBGS, ALADH, MGC5057, Lv, ALADR, aminolevulinatedelta-dehydratase, ALAD, ncf, zgc:110219, CH73-203I15.1
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN310192
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name ALAD
Gene ID ALAD
UniProt Q6ZMU0
Immunogen The immunogen for anti-ALAD antibody: synthetic peptide directed towards the middle region of human ALAD
Sequence SVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGAR GLALRAVDRD
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-ALAD antibody concentration is 1 mg/ml.
Description The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway, zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria.The ALAD enzyme is composed of 8 identical subunits and catalyzes the condensation of 2 molecules of delta-aminolevulinate to form porphobilinogen (a precursor of heme, cytochromes and other hemoproteins). ALAD catalyzes the second step in the porphyrin and heme biosynthetic pathway, zinc is essential for enzymatic activity. ALAD enzymatic activity is inhibited by lead and a defect in the ALAD structural gene can cause increased sensitivity to lead poisoning and acute hepatic porphyria. Alternatively spliced transcript variants encoding different isoforms have been identified.
Characteristics Antigen Size: 359 amino acids
Molecular Weight 39kDa

Application Details

Application Notes WB Suggested Anti-ALAD Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Tang, Breinig, Stith et al.: "Single amino acid mutations alter the distribution of human porphobilinogen synthase quaternary structure isoforms (morpheeins)." in: The Journal of biological chemistry, Vol. 281, Issue 10, pp. 6682-90, 2006 (PubMed).

Alternatives

Alternatives for antigen "Aminolevulinate Dehydratase (ALAD)", type "Antibodies"
Hosts Rabbit (33)
Reactivities Human (29), Mouse (Murine) (21), Cow (Bovine) (19), Rat (Rattus) (19), Dog (Canine) (1), Xenopus laevis (1), Zebrafish (1)
Applications Western Blotting (WB) (18), Immunofluorescence (IF) (14), ELISA (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (IHC) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Flow Cytometry (FACS) (1), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (6), C-Term (2), C-Term,AA 251-280 (1), Internal Region (1)