Alkaline Phosphatase, Placental (ALP) antibody

Antigen: Alkaline Phosphatase, Placental (ALP)

Synonyms: ALP, PALP, PLAP, FLJ61142, Akp2, MGC56672, zgc:56672, HOPS, TNAP, TNSALP, AP-TNAP, FLJ40094, FLJ93059, MGC161443, MGC167935, Akp-2, PHOA, MGC93545, ALPL, TNS-AP, MGC139479, alpl, MGC52917, MGC130818, ECK0378, JW0374, psiA, iap

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus), Xenopus laevis

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN310261

Additional Information

Alternative name: Alkaline phosphatase / PLAP / ALPP

Gene ID: ALPP

UniProt: P05187

Immunogen: The immunogen for anti-ALPP antibody: synthetic peptide directed towards the C terminal of human ALPP

Sequence: TVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLD EETHAGEDVA

Cross-Reactivity: Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ALPP antibody concentration is 1 mg/ml.

Description: There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. ALPP is a membrane bound glycosylated enzyme, also referred to as the heat stable form, that is expressed primarily in the placenta although it is closely related to the intestinal form of the enzyme as well as to the placental-like form.There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2 while the tissue non-specific form is located on chromosome 1. The product of this gene is a membrane bound glycosylated enzyme, also referred to as the heat stable form, that is expressed primarily in the placenta although it is closely related to the intestinal form of the enzyme as well as to the placental-like form. The coding sequence for this form of alkaline phosphatase is unique in that the 3' untranslated region contains multiple copies of an Alu family repeat. In addition, this gene is polymorphic and three common alleles (type 1, type 2 and type 3) for this form of alkaline phosphatase have been well characterized.

Characteristics: Antigen Size: 535 amino acids

Molecular Weight: 59kDa

Synonyms: ALP, PALP, PLAP, FLJ61142, Akp2, MGC56672, zgc:56672, HOPS, TNAP, TNSALP, AP-TNAP, FLJ40094, FLJ93059, MGC161443, MGC167935, Akp-2, PHOA, MGC93545, ALPL, TNS-AP, MGC139479, alpl, MGC52917, MGC130818, ECK0378, JW0374, psiA, iap

Application Details

Application Notes: WB Suggested Anti-ALPP Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Enzymes

Restrictions: For Research Use only

Images

WB Suggested Anti-ALPP Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate

anti-Alkaline Phosphatase, Placental (ALP) antibody (Image 2)

Publications

Product: Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).