Dihydrolipoyl Transacetylase (DLAT) antibody

Antigen: Dihydrolipoyl Transacetylase (DLAT)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Xenopus laevis, Zebrafish, Chicken

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN310264

Additional Information

Alternative name: DLAT / DLTA

Gene ID: DLAT

UniProt: Q86YI5

Immunogen: The immunogen for anti-DLAT antibody: synthetic peptide directed towards the N terminal of human DLAT

Sequence: WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLS PTMQAGTIAR

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-DLAT antibody concentration is 1 mg/ml.

Description: DLAT is dihydrolipoamide acetyltransferase, the E2 subunit of the mammalian pyruvate dehydrogenase complex of the inner mitochondrial membrane. Patients with primary biliary cirrhosis show autoantibodies to DLAT.The DLAT gene encodes dihydrolipoamide acetyltransferase (EC 2.3.1.12), the E2 subunit of the mammalian pyruvate dehydrogenase complex (PDC, EC 1.2.4.1) of the inner mitochondrial membrane. Patients with primary biliary cirrhosis (PBC, MIM 109720) show autoantibodies to DLAT.[supplied by OMIM].

Characteristics: Antigen Size: 647 amino acids

Molecular Weight: 71kDa

Application Details

Application Notes: WB Suggested Anti-DLAT Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-DLAT Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate

Sample Type: Huh7 lysate (50ug)
Primary Antibody Dilution: 1:200
Image Submitted By: Partha Kasturi
University of Kansas Medical Center

anti-Dihydrolipoyl Transacetylase (DLAT) antibody (Image 3)

Publications

Product: Head, Brown, Zolkipli et al.: "Clinical and genetic spectrum of pyruvate dehydrogenase deficiency: dihydrolipoamide acetyltransferase (E2) deficiency." in: Annals of neurology, Vol. 58, Issue 2, pp. 234-41, 2005 (PubMed).