Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310285

Thiosulfate Sulfurtransferase (Rhodanese) (TST) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RDS, Rhodanese, RHODAN, cysA, SCD66.01, SCD84.31, An12g01520, SPCP25A2.01c, AO090010000212
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310285
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TST antibody: synthetic peptide directed towards the middle region of human TST
Sequence GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHP VTSEPSRPEP
Predicted Reactivity Dog : 100%, Human : 100%, Mouse : 100%, Pig : 92%, Chicken : 84%
Characteristics This is a rabbit polyclonal antibody against TST. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name TST
Background TST is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.The product of this gene is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The gene product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin. Additional Information IHC Information: Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE) IHC Information: Human Liver: Formalin-Fixed, Paraffin-Embedded (FFPE)
Molecular Weight 33kDa
Gene ID 7263
NCBI Accession NP_003303, NM_003312
UniProt Q16762
Research Area Signaling, Metabolism, Organelles
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TST antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Matthies, Nimtz, Leimkühler: "Molybdenum cofactor biosynthesis in humans: identification of a persulfide group in the rhodanese-like domain of MOCS3 by mass spectrometry." in: Biochemistry, Vol. 44, Issue 21, pp. 7912-20, 2005 (PubMed).

Alternatives for antigen "Thiosulfate Sulfurtransferase (Rhodanese) (TST)", type "Antibodies"
Hosts (8), (1)
Reactivities (8), (3), (2)
Applications (9), (4), (3), (2), (1)
Epitopes (1), (1), (1)
Beacon