Thiosulfate Sulfurtransferase (Rhodanese) (TST) antibody

Antigen: Thiosulfate Sulfurtransferase (Rhodanese) (TST)

Synonyms: RDS, MGC19578, cysA, SCD66.01, SCD84.31

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN310285

Additional Information

Alternative name: Thiosulfate sulfurtransferase (TST)

Gene ID: TST

UniProt: Q16762

Immunogen: The immunogen for anti-TST antibody: synthetic peptide directed towards the middle region of human TST

Sequence: GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHP VTSEPSRPEP

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-TST antibody concentration is 1 mg/ml.

Description: TST is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.The product of this gene is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The gene product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.

Characteristics: Antigen Size: 297 amino acids

Molecular Weight: 33kDa

Application Details

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

anti-Thiosulfate Sulfurtransferase (Rhodanese) (TST) antibody

anti-Thiosulfate Sulfurtransferase (Rhodanese) (TST) antibody (Image 2)

anti-Thiosulfate Sulfurtransferase (Rhodanese) (TST) antibody (Image 3)

Publications

Product: Matthies, Nimtz, Leimkühler: "Molybdenum cofactor biosynthesis in humans: identification of a persulfide group in the rhodanese-like domain of MOCS3 by mass spectrometry." in: Biochemistry, Vol. 44, Issue 21, pp. 7912-20, 2005 (PubMed).