Integrin, beta-Like 1 (With EGF-Like Repeat Domains) (ITGBL1) antibody

Antigen: Integrin, beta-Like 1 (With EGF-Like Repeat Domains) (ITGBL1)

Synonyms: OSCP, TIED, ITGBL1, MGC99074

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Dog (Canine), Rat (Rattus), Mouse (Murine)

Application: Western Blotting (WB)

Catalog no.: ABIN310296

Additional Information

Alternative name: ITGBL1

Gene ID: ITGBL1

UniProt: O95965

Immunogen: The immunogen for anti-ITGBL1 antibody: synthetic peptide directed towards the N terminal of human ITGBL1

Sequence: MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAAC RLSRAESERR

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-ITGBL1 antibody concentration is 1 mg/ml.

Description: The function remains unknown.

Characteristics: Antigen Size: 494 amino acids

Molecular Weight: 54kDa

Application Details

Application Notes: WB Suggested Anti-ITGBL1 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ITGBL1 Antibody Titration: 2.5ug/ml
Positive Control: Jurkat cell lysate

Publications

Product: Chumakov, Blumenfeld, Guerassimenko et al.: "Genetic and physiological data implicating the new human gene G72 and the gene for D-amino acid oxidase in schizophrenia." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 21, pp. 13675-80, 2002 (PubMed).