Actinin, alpha 4 (ACTN4) antibody
| Antigen | Actinin, alpha 4 (ACTN4) |
| Synonyms | FSGS, FSGS1, ACTININ-4, DKFZp686K23158, C77391, MGC102374, zgc:63508, wu:fb53f05, ACTN4, actn4, MGC80841, fsgs, fsgs1, MGC79707, DKFZp468L096 |
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Reactivity |
Alternatives Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Xenopus laevis, Zebrafish |
| Conjugate |
Alternatives Un-conjugated |
| Application |
Alternatives Western Blotting (WB) |
 |
2 references available |
| Catalog no. | ABIN310298 |
| Quantity | 0.1 mg (Variants) |
| Price | 251.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | Alpha-actinin-4 / ACTN4 |
| Gene ID | ACTN4 |
| UniProt | O43707 |
| Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the N terminal of human ACTN4 |
| Sequence | LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKM LDAEDIVNTA |
| Cross-Reactivity | Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus) |
| Format | Lyophilized |
| Reconstitution | Add 100 µl of distilled water. Final anti-ACTN4 antibody concentration is 1 mg/ml. |
| Description | Alpha actinins belong to the spectrin superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. ACTN4 is a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in its gene have been associated with focal and segmental glomerulosclerosis.Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in this gene have been associated with focal and segmental glomerulosclerosis. |
| Characteristics | Antigen Size: 911 amino acids |
| Molecular Weight | 100kDa |
Application Details
| Application Notes |
WB Suggested Anti-ACTN4 Antibody Titration: 0.625ug/ml Positive Control: HCT116 cell lysate. |
| Purification | Protein A purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Restrictions | For Research Use only |
Publications
| Product |
Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).
Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed). |
Alternatives
Alternatives for antigen "Actinin, alpha 4 (ACTN4)", type "Antibodies"
