Actinin, alpha 4 (ACTN4) antibody

Antigen: Actinin, alpha 4 (ACTN4)

Synonyms: FSGS, FSGS1, ACTININ-4, DKFZp686K23158, C77391, MGC102374, zgc:63508, wu:fb53f05, ACTN4, actn4, MGC80841, fsgs, fsgs1, MGC79707, DKFZp468L096

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Xenopus laevis, Zebrafish

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN310299

Additional Information

Alternative name: Alpha-actinin-4 / ACTN4

Gene ID: ACTN4

UniProt: O43707

Immunogen: The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the C terminal of human ACTN4

Sequence: DVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRET TDTDTADQVI

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ACTN4 antibody concentration is 1 mg/ml.

Description: Alpha actinins belong to the spectrin superfamily which is a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. ACTN4 is a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in its gene have been associated with focal and segmental glomerulosclerosis.Alpha actinins belong to the spectrin gene superfamily which represents a diverse group of cytoskeletal proteins, including the alpha and beta spectrins and dystrophins. Alpha actinin is an actin-binding protein with multiple roles in different cell types. In nonmuscle cells, the cytoskeletal isoform is found along microfilament bundles and adherens-type junctions, where it is involved in binding actin to the membrane. In contrast, skeletal, cardiac, and smooth muscle isoforms are localized to the Z-disc and analogous dense bodies, where they help anchor the myofibrillar actin filaments. This gene encodes a nonmuscle, alpha actinin isoform which is concentrated in the cytoplasm, and thought to be involved in metastatic processes. Mutations in this gene have been associated with focal and segmental glomerulosclerosis.

Characteristics: Antigen Size: 911 amino acids

Molecular Weight: 105kDa

Application Details

Application Notes: WB Suggested Anti-ACTN4 Antibody Titration: 0.2-1 ug/ml
Positive Control: HCT116 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ACTN4 Antibody Titration: 0.2-1 ug/ml
Positive Control: HCT116 cell lysate

Publications

Product: Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).