Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310317

Solute Carrier Family 22 (Organic Cation Transporter), Member 7 (SLC22A7) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NLT, OAT2, Oat2, oat2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rabbit, Rat (Rattus), Cow (Bovine), Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN310317
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SLC22A7 antibody: synthetic peptide directed towards the N terminal of human SLC22A7
Sequence LPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALP NTTLGEERQS
Predicted Reactivity Horse : 100%, Human : 100%, Guinea pig : 92%
Characteristics This is a rabbit polyclonal antibody against SLC22A7. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name SLC22A7
Background SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.
Molecular Weight 60kDa
Gene ID 10864
NCBI Accession NP_006663, NM_006672
UniProt Q5T048
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SLC22A7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Alternatives for antigen "Solute Carrier Family 22 (Organic Cation Transporter), Member 7 (SLC22A7)", type "Antibodies"
Hosts (13)
Reactivities (8), (4), (2), (1), (1), (1), (1)
Applications (11), (6), (3), (1)
Epitopes (5), (3)
Beacon