Solute Carrier Family 22 (Organic Cation Transporter), Member 7 (SLC22A7) antibody

Antigen: Solute Carrier Family 22 (Organic Cation Transporter), Member 7 (SLC22A7)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Rat (Rattus), Pig (Porcine), Rabbit

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN310317

Additional Information

Alternative name: SLC22A7 / OAT2

Gene ID: SLC22A7

UniProt: Q5T048

Immunogen: The immunogen for anti-SLC22A7 antibody: synthetic peptide directed towards the N terminal of human SLC22A7

Sequence: LPGAPANFSHQDVWLEAHLPREPDGTLSSCLRFAYPQALP NTTLGEERQS

Cross-Reactivity: Cow (Bovine), Human, Pig (Porcine), Rabbit, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-SLC22A7 antibody concentration is 1 mg/ml.

Description: SLC22A7 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney.The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described.

Characteristics: Antigen Size: 546 amino acids

Molecular Weight: 60kDa

Application Details

Application Notes: WB Suggested Anti-SLC22A7 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SLC22A7 Antibody Titration: 5.0ug/ml
Positive Control: Jurkat cell lysate

anti-Solute Carrier Family 22 (Organic Cation Transporter), Member 7 (SLC22A7) antibody (Image 2)

Publications

Product: Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).