Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Family with Sequence Similarity 107, Member A (FAM107A) antibody

Antigen

Family with Sequence Similarity 107, Member A (FAM107A)

Synonyms DRR1, TU3A, FLJ30158, FLJ45473
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN310325
Quantity 0.1 mg
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name FAM107A
Gene ID FAM107A
UniProt O95990
Immunogen The immunogen for anti-FAM107A antibody: synthetic peptide directed towards the middle region of human FAM107A
Sequence RLQCPFEQELLRRQQRLNQLEKPPEKEEDHAPEFIKVREN LRRIATLTSE
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-FAM107A antibody concentration is 1 mg/ml.
Description When FAM107A is transfected into cell lines in which it is not expressed, it suppresses cell growth. It may play a role in tumor development.
Characteristics Antigen Size: 144 amino acids
Molecular Weight 17kDa

Application Details

Application Notes WB Suggested Anti-FAM107A Antibody Titration: 0.0625ug/ml
Positive Control: Transfected 293T.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Cancer
Restrictions For Research Use only

Publications

Product Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives

Alternatives for antigen "Family with Sequence Similarity 107, Member A (FAM107A)", type "Antibodies"
Hosts Rabbit (20)
Reactivities Human (19), Chicken (17), Cow (Bovine) (17), Dog (Canine) (17), Mouse (Murine) (17), Pig (Porcine) (17), Rat (Rattus) (17)
Applications Immunofluorescence (IF) (15), ELISA (4), Western Blotting (WB) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes Internal Region (1)