Did you know that you can buy products from over 140 different suppliers from us?

Pipecolic Acid Oxidase (PIPOX) (C-Term) antibody

Details for Product No. ABIN310346
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Pso, LPIPOX, SOX
Epitope
C-Term
(2), (2), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human
(13), (6), (2), (2), (1), (1), (1)
Host
Rabbit
(14), (11), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (1), (1)
Application
Western Blotting (WB)
(23), (21), (9), (4), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN310346
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human PIPOX
Sequence FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNI VIGAGFSGHG
Predicted Reactivity African clawed frog : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Guinea pig : 90 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against PIPOX. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PIPOX
Background PIPOX metabolizes sarcosine, L-pipecolic acid and L-proline.
Molecular Weight 43 kDa
Gene ID 51268
NCBI Accession NM_016518, NP_057602
UniProt Q9P0Z9
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 390 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Pipecolic Acid Oxidase (PIPOX) (C-Term) antibody WB Suggested Anti-PIPOX Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Background publications IJlst, de Kromme, Oostheim et al.: "Molecular cloning and expression of human L-pipecolate oxidase." in: Biochemical and biophysical research communications, Vol. 270, Issue 3, pp. 1101-5, 2000 (PubMed).

Hosts (14), (11), (2)
Reactivities (13), (6), (2), (2), (1), (1), (1)
Applications (23), (21), (9), (4), (2), (1), (1)
Conjugates (2), (1), (1)
Epitopes (2), (2), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310346
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top