Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310346

Pipecolic Acid Oxidase (PIPOX) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Pso, LPIPOX, SOX
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310346
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PIPOX antibody: synthetic peptide directed towards the C terminal of human PIPOX
Sequence FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNI VIGAGFSGHG
Predicted Reactivity African clawed frog : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Guinea pig : 92%, Zebrafish : 84%
Characteristics This is a rabbit polyclonal antibody against PIPOX. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PIPOX
Background PIPOX metabolizes sarcosine, L-pipecolic acid and L-proline.
Molecular Weight 43kDa
Gene ID 51268
NCBI Accession NP_057602, NM_016518
UniProt Q9P0Z9
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PIPOX antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications IJlst, de Kromme, Oostheim et al.: "Molecular cloning and expression of human L-pipecolate oxidase." in: Biochemical and biophysical research communications, Vol. 270, Issue 3, pp. 1101-5, 2000 (PubMed).

Alternatives for antigen "Pipecolic Acid Oxidase (PIPOX)", type "Antibodies"
Hosts (20), (8), (2)
Reactivities (8), (7), (5), (4), (2), (1), (1), (1)
Applications (26), (24), (13), (2), (2), (1), (1)
Conjugates (4), (3), (3)
Epitopes (1), (1), (1), (1), (1)
Beacon