Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Family with Sequence Similarity 129, Member A (FAM129A) antibody

Antigen

Family with Sequence Similarity 129, Member A (FAM129A)

Synonyms GIG39, NIBAN, C1orf24, FLJ38228
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN310380
Quantity 0.1 mg
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name Niban
Gene ID FAM129A
UniProt Q9BZQ8
Immunogen The immunogen for anti-FAM129A antibody: synthetic peptide directed towards the N terminal of human FAM129A
Sequence SYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHF PDPLASSEKE
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-FAM129A antibody concentration is 1 mg/ml.
Description FAM129A is expressed in subsets of thyroid tumors and Hashimoto's thyroiditis and it is a novel tumor marker.
Characteristics Antigen Size: 928 amino acids
Molecular Weight 103kDa

Application Details

Application Notes WB Suggested Anti-FAM129A Antibody Titration: 1.25ug/ml
Positive Control: Transfected 293T.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Matsumoto, Fujii, Abe et al.: "A novel tumor marker, Niban, is expressed in subsets of thyroid tumors and Hashimoto's thyroiditis." in: Human pathology, Vol. 37, Issue 12, pp. 1592-600, 2006 (PubMed).

Alternatives

Alternatives for antigen "Family with Sequence Similarity 129, Member A (FAM129A)", type "Antibodies"
Hosts Rabbit (35)
Reactivities Human (34), Mouse (Murine) (21), Rat (Rattus) (21), Chicken (19), Horse (Equine) (18), Cat (Feline) (1), Cow (Bovine) (1), Dog (Canine) (1)
Applications Immunofluorescence (IF) (20), Western Blotting (WB) (20), ELISA (8), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (5), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoprecipitation (IP) (2), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes AA 908-920 (3), pSer602 (2), N-Term (1)