Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Autocrine Motility Factor Receptor (AMFR) (Isoform 2) antibody

Antigen

Autocrine Motility Factor Receptor (AMFR)

Synonyms GP78, RNF45, gp78, MGC68459, zgc:63893, wu:fi06e06, wu:fi37e05, AMFR, MGC134057, rnf45
Binding Site
Alternatives

Isoform 2

Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish, Xenopus laevis

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN310408
Quantity 100 µg
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name AMFR / RNF45
Gene ID AMFR
UniProt Q6PGR1
Immunogen The immunogen for anti-AMFR antibody: synthetic peptide directed towards the C terminal of human AMFR
Sequence FGEVEVEPSEVEDFEARGSRFSKSADERQRMLVQRKDELL QQARKRFLNK
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-AMFR antibody concentration is 1 mg/ml.
Description Autocrine motility factor is a tumor motility-stimulating protein secreted by tumor cells. AMFR is a glycosylated transmembrane protein and a receptor for autocrine motility factor. The receptor, which shows some sequence similarity to tumor protein p53, is localized to the leading and trailing edges of carcinoma cells.The Makorin ring finger protein-1 gene (MKRN1) is a highly transcribed, intron-containing source for a family of intronless mammalian genes encoding a novel class of zinc finger proteins. Phylogenetic analyses indicate that the MKRN1 gene is the ancestral founder of this gene family (Gray et al., 2000).[supplied by OMIM].
Characteristics Antigen Size: 482 amino acids
Molecular Weight 53kDa

Application Details

Application Notes WB Suggested Anti-AMFR Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Lehner, Sanderson: "A protein interaction framework for human mRNA degradation." in: Genome research, Vol. 14, Issue 7, pp. 1315-23, 2004 (PubMed).

Alternatives

Alternatives for antigen "Autocrine Motility Factor Receptor (AMFR)", type "Antibodies"
Hosts Rabbit (36)
Reactivities Human (31), Mouse (Murine) (27), Rat (Rattus) (22), Chicken (19), Cow (Bovine) (19), Dog (Canine) (19), Cat (Feline) (1)
Applications Immunofluorescence (IF) (19), Western Blotting (WB) (19), ELISA (15), Immunohistochemistry (IHC) (9), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (6), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoprecipitation (IP) (2), Flow Cytometry (FACS) (1), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (Frozen Sections) (IHC (fro)) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes N-Term (3), C-Term (2)