Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

THO Complex 4 (THOC4) antibody

Antigen

THO Complex 4 (THOC4)

Synonyms ALY, BEF, REF1, Refbp1, THOC4, MGC127512, Thoc4, Aly
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Zebrafish, Chicken, Xenopus laevis

Application
Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
1 reference available
Catalog no. ABIN310422
Quantity 0.1 mg
Price 251.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name THOC4 / ALY
Gene ID THOC4
UniProt Q86V81
Immunogen The immunogen for anti-THOC4 antibody: synthetic peptide directed towards the N terminal of human THOC4
Sequence GGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHD LFDSGFGGGA
Cross-Reactivity Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 100 µl of distilled water. Final anti-THOC4 antibody concentration is 1 mg/ml.
Description THOC4 is a heat stable, nuclear protein and functions as a molecular chaperone. It is thought to regulate dimerization, DNA binding, and transcriptional activity of basic region-leucine zipper (bZIP) proteins.The protein encoded by this gene is a heat stable, nuclear protein and functions as a molecular chaperone. It is thought to regulate dimerization, DNA binding, and transcriptional activity of basic region-leucine zipper (bZIP) proteins.
Characteristics Antigen Size: 257 amino acids
Molecular Weight 28kDa

Application Details

Application Notes WB Suggested Anti-THOC4 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate.
Purification Protein A purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Strässer, Masuda, Mason et al.: "TREX is a conserved complex coupling transcription with messenger RNA export." in: Nature, Vol. 417, Issue 6886, pp. 304-8, 2002 (PubMed).

Alternatives

Alternatives for antigen "THO Complex 4 (THOC4)", type "Antibodies"
Hosts Mouse (7), Rabbit (7)
Reactivities Human (12), Xenopus laevis (4), Mouse (Murine) (2), Rat (Rattus) (2)
Applications Western Blotting (WB) (13), ELISA (9), Immunofluorescence (IF) (6), Immunoprecipitation (IP) (6), Immunocytochemistry (ICC) (3), Immunohistochemistry (IHC) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1)
Epitopes N-Term (1)