Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310463

Tripartite Motif Containing 42 (TRIM42) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4930486B16Rik, PPP1R40, TRIM42
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN310463
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TRIM42 antibody: synthetic peptide directed towards the C terminal of human TRIM42
Sequence VKTPGPIVIYQTLVYPRAAKVYWTCPAEDVDSFEMEFYEV ITSPPNNVQM
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Pig : 100%, Rat : 100%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against TRIM42. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TRIM42
Background TRIM42 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, namely a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.This gene encodes a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, namely a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.
Molecular Weight 80kDa
Gene ID 287015
NCBI Accession NP_689829, NM_152616
UniProt Q8IWZ5
Research Area Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TRIM42 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Reymond, Meroni, Fantozzi et al.: "The tripartite motif family identifies cell compartments." in: The EMBO journal, Vol. 20, Issue 9, pp. 2140-51, 2001 (PubMed).

Alternatives for antigen "Tripartite Motif Containing 42 (TRIM42)", type "Antibodies"
Hosts (6)
Reactivities (4)
Applications (5), (1)
Epitopes (2), (2), (1), (1), (1)
Beacon